PDB entry 1mdj

View 1mdj on RCSB PDB site
Description: high resolution solution nmr structure of mixed disulfide intermediate between human thioredoxin (c35a, c62a, c69a, c73a) mutant and a 13 residue peptide comprising its target site in human nfkb (residues 56-68 of the p50 subunit of nfkb)
Deposited on 1995-02-27, released 1995-06-03
The last revision prior to the SCOP 1.59 freeze date was dated 1995-07-20, with a file datestamp of 1995-08-14.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1mdja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mdjA (A:)
  mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
  daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv