PDB entry 1mda

View 1mda on RCSB PDB site
Description: crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin
Class: electron transport
Keywords: electron transport
Deposited on 1992-03-02, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.285
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1mdaa_
  • Chain 'B':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1mdab_
  • Chain 'H':
    Compound: methylamine dehydrogenase (heavy subunit)
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MDA (0-367)
    Domains in SCOPe 2.04: d1mdah_
  • Chain 'J':
    Compound: methylamine dehydrogenase (heavy subunit)
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MDA (0-367)
    Domains in SCOPe 2.04: d1mdaj_
  • Chain 'L':
    Compound: methylamine dehydrogenase (light subunit)
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • PIR A44544 (0-120)
      • conflict (50)
    Domains in SCOPe 2.04: d1mdal_
  • Chain 'M':
    Compound: methylamine dehydrogenase (light subunit)
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • PIR A44544 (0-120)
      • conflict (50)
    Domains in SCOPe 2.04: d1mdam_
  • Heterogens: CU

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdaA (A:)
    atipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvagvl
    geaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdaB (B:)
    atipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvagvl
    geaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdaH (H:)
    ekskvagsaaaasaaaasdgsscdhgpgaisrrshitlpayfagttenwvscagcgvtlg
    hslgaflslavaghsgsdfalastsfarsakgkrtdyvevfdpvtflpiadielpdaprf
    svgprvhiigncassacllfflfgssaaaglsvpgasddqltksascfhihpgaaathyl
    gscpaslaasdlaaapaaagivgaqctgaqncssqaaqanypgmlvwavassilqgdipa
    agatmkaaidgnesgrkadnfrsagfqmvaklkntdgimiltvehsrsclaaaentssvt
    asvgqtsgpisnghdsdaiiaaqdgasdnyansagtevldiydaasdqdqssveldkgpe
    slsvqnea
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdaJ (J:)
    ekskvagsaaaasaaaasdgsscdhgpgaisrrshitlpayfagttenwvscagcgvtlg
    hslgaflslavaghsgsdfalastsfarsakgkrtdyvevfdpvtflpiadielpdaprf
    svgprvhiigncassacllfflfgssaaaglsvpgasddqltksascfhihpgaaathyl
    gscpaslaasdlaaapaaagivgaqctgaqncssqaaqanypgmlvwavassilqgdipa
    agatmkaaidgnesgrkadnfrsagfqmvaklkntdgimiltvehsrsclaaaentssvt
    asvgqtsgpisnghdsdaiiaaqdgasdnyansagtevldiydaasdqdqssveldkgpe
    slsvqnea
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdaL (L:)
    vdprakwqpqdndiqacdywrhcsiagnicdcsagsltscppgtlvasgswvgscynppd
    pnkyitayrdccgynvsgrcaclntegelpvynkdandiiwcfggedgmtyhcsispvsg
    a
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdaM (M:)
    vdprakwqpqdndiqacdywrhcsiagnicdcsagsltscppgtlvasgswvgscynppd
    pnkyitayrdccgynvsgrcaclntegelpvynkdandiiwcfggedgmtyhcsispvsg
    a