PDB entry 1mda

View 1mda on RCSB PDB site
Description:
Deposited on 1992-03-02, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.285
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1mdaa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1mdab_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1mdah_
  • Chain 'J':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1mdaj_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1mdal_
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1mdam_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdaA (A:)
    atipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvagvl
    geaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdaB (B:)
    atipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvagvl
    geaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdaH (H:)
    ekskvagsaaaasaaaasdgsscdhgpgaisrrshitlpayfagttenwvscagcgvtlg
    hslgaflslavaghsgsdfalastsfarsakgkrtdyvevfdpvtflpiadielpdaprf
    svgprvhiigncassacllfflfgssaaaglsvpgasddqltksascfhihpgaaathyl
    gscpaslaasdlaaapaaagivgaqctgaqncssqaaqanypgmlvwavassilqgdipa
    agatmkaaidgnesgrkadnfrsagfqmvaklkntdgimiltvehsrsclaaaentssvt
    asvgqtsgpisnghdsdaiiaaqdgasdnyansagtevldiydaasdqdqssveldkgpe
    slsvqnea
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdaJ (J:)
    ekskvagsaaaasaaaasdgsscdhgpgaisrrshitlpayfagttenwvscagcgvtlg
    hslgaflslavaghsgsdfalastsfarsakgkrtdyvevfdpvtflpiadielpdaprf
    svgprvhiigncassacllfflfgssaaaglsvpgasddqltksascfhihpgaaathyl
    gscpaslaasdlaaapaaagivgaqctgaqncssqaaqanypgmlvwavassilqgdipa
    agatmkaaidgnesgrkadnfrsagfqmvaklkntdgimiltvehsrsclaaaentssvt
    asvgqtsgpisnghdsdaiiaaqdgasdnyansagtevldiydaasdqdqssveldkgpe
    slsvqnea
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdaL (L:)
    vdprakwqpqdndiqacdywrhcsiagnicdcsagsltscppgtlvasgswvgscynppd
    pnkyitayrdccgynvsgrcaclntegelpvynkdandiiwcfggedgmtyhcsispvsg
    a
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdaM (M:)
    vdprakwqpqdndiqacdywrhcsiagnicdcsagsltscppgtlvasgswvgscynppd
    pnkyitayrdccgynvsgrcaclntegelpvynkdandiiwcfggedgmtyhcsispvsg
    a