PDB entry 1md6

View 1md6 on RCSB PDB site
Description: High resolution crystal structure of murine IL-1F5 reveals unique loop conformation for specificity
Class: immune system
Keywords: beta triple, alpha helix, IMMUNE SYSTEM
Deposited on 2002-08-07, released 2003-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.204
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin 1 family, member 5 (delta)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1md6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1md6A (A:)
    vlsgalcfrmkdsalkvlylhnnqllagglhaekvikgeeisvvpnraldaslspvilgv
    qggsqclscgtekgpilklepvnimelylgakesksftfyrrdmgltssfesaaypgwfl
    ctspeadqpvrltqipedpawdapitdfyfqqcd