PDB entry 1md6

View 1md6 on RCSB PDB site
Description: High resolution crystal structure of murine IL-1F5 reveals unique loop conformation for specificity
Deposited on 2002-08-07, released 2003-09-30
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-30, with a file datestamp of 2003-09-30.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.204
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1md6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1md6A (A:)
    vlsgalcfrmkdsalkvlylhnnqllagglhaekvikgeeisvvpnraldaslspvilgv
    qggsqclscgtekgpilklepvnimelylgakesksftfyrrdmgltssfesaaypgwfl
    ctspeadqpvrltqipedpawdapitdfyfqqcd