PDB entry 1mcy

View 1mcy on RCSB PDB site
Description: sperm whale myoglobin (mutant with initiator met and with his 64 replaced by gln, leu 29 replaced by phe
Class: myoglobin (carbonmonoxy)
Keywords: heme, oxygen transport, respiratory protein, myoglobin (carbonmonoxy)
Deposited on 1995-07-19, released 1995-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myoglobin (carbonmonoxy)
    Species: Physeter catodon, synthetic [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • engineered (29)
      • engineered (64)
    Domains in SCOPe 2.08: d1mcya_
  • Heterogens: SO4, HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcyA (A:)
    mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
    dlkkqgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg