PDB entry 1mcw

View 1mcw on RCSB PDB site
Description: three-dimensional structure of a hybrid light chain dimer. protein engineering of a binding cavity
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1989-05-09, released 1990-10-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.17
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: immunoglobulin mcg (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR S14675 (1-215)
      • conflict (19)
      • conflict (22)
      • conflict (28)
      • conflict (30)
      • conflict (38)
      • conflict (41)
      • conflict (47-48)
      • conflict (53)
      • conflict (61)
      • conflict (93)
      • conflict (96-99)
      • conflict (102)
      • conflict (105-106)
      • conflict (115)
      • conflict (117)
      • conflict (155)
      • conflict (166)
    Domains in SCOPe 2.03: d1mcwm1, d1mcwm2
  • Chain 'W':
    Compound: immunoglobulin weir (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR S25758 (1-214)
      • conflict (19)
      • conflict (22)
      • conflict (24-25)
      • conflict (29-31)
      • conflict (33-34)
      • conflict (37)
      • conflict (42)
      • conflict (48)
      • conflict (51)
      • conflict (54)
      • conflict (59-61)
      • conflict (80)
      • conflict (82)
      • conflict (88)
      • conflict (90)
      • conflict (92-93)
      • insertion (95)
      • conflict (96)
      • conflict (102)
      • conflict (107)
      • conflict (110)
      • conflict (159)
    Domains in SCOPe 2.03: d1mcww1, d1mcww2

PDB Chain Sequences:

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mcwM (M:)
esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
ylsltpeqwkshrsyscqvthegstvektvaptecs

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mcwW (W:)
esaltqpasvsgspgqsitvscaghtsdvadsnsiswfqqhpdkapklliyavtfrpsgi
plrfsgsksgntasltisgllpddeadyfcmsylsdasfvfgsgtkvtvlrqpkanptvt
lfppsseelqankatlvclisdfypgavtvawkadgspveagvettkpskqsnnkyaass
ylsltpeqwkshrsyscqvthegstvektvaptecs