PDB entry 1mcv

View 1mcv on RCSB PDB site
Description: Crystal Structure Analysis of a Hybrid Squash Inhibitor in Complex with Porcine Pancreatic Elastase
Class: hydrolase
Keywords: elastase-inhibitor complex, hybrid squash inhibitor, HYDROLASE
Deposited on 2002-08-06, released 2003-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elastase 1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mcva_
  • Chain 'I':
    Compound: hei-toe I
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MCV (0-27)
    Domains in SCOPe 2.07: d1mcvi_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcvA (A:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcvI (I:)
    pctleymrckqdsdclagcvcgpngfcg