PDB entry 1mcv

View 1mcv on RCSB PDB site
Description: Crystal Structure Analysis of a Hybrid Squash Inhibitor in Complex with Porcine Pancreatic Elastase
Class: hydrolase
Keywords: elastase-inhibitor complex, hybrid squash inhibitor
Deposited on 2002-08-06, released 2003-02-04
The last revision prior to the SCOP 1.75 freeze date was dated 2003-02-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elastase 1
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1mcva_
  • Chain 'I':
    Compound: hei-toe I
    Species: synthetic, synthetic
    Domains in SCOP 1.75: d1mcvi_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mcvA (A:)
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mcvI (I:)
pctleymrckqdsdclagcvcgpngfcg