PDB entry 1mcu

View 1mcu on RCSB PDB site
Description: crystal structure of the complex formed between bovine beta-trypsin and mcti-a, a trypsin inhibitor of squash family at 1.8a resolution
Class: hydrolase/hydrolase inhibitor
Keywords: complex(proteinase/inhibitor)
Deposited on 1999-05-05, released 1999-05-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2003-04-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: protein (trypsin)
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mcue_
  • Chain 'I':
    Compound: protein (trypsin inhibitor a)
    Species: MOMORDICA CHARANTIA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mcui_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcuE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdscksaypgqitsnmfcagyleggkdscqgdsggpv
    vcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcuI (I:)
    ricpriwmeckrdsdcmaecicvmghcg