PDB entry 1mct

View 1mct on RCSB PDB site
Description: the refined 1.6 angstroms resolution crystal structure of the complex formed between porcine beta-trypsin and mcti-a, a trypsin inhibitor of squash family
Deposited on 1992-10-24, released 1994-01-15
The last revision prior to the SCOP 1.61 freeze date was dated 1994-01-15, with a file datestamp of 1995-01-19.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.167
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1mcta_
  • Chain 'I':
    Domains in SCOP 1.61: d1mcti_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mctA (A:)
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
wgntkssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggp
vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mctI (I:)
ricpriwmectrdsdcmakcicvaghcg