PDB entry 1mcs

View 1mcs on RCSB PDB site
Description: principles and pitfalls in designing site directed peptide ligands
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-02-25, released 1994-01-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.183
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin lambda dimer mcg (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR S14675 (1-215)
      • conflict (19)
      • conflict (22)
      • conflict (28)
      • conflict (30)
      • conflict (38)
      • conflict (41)
      • conflict (47-48)
      • conflict (53)
      • conflict (61)
      • conflict (93)
      • conflict (96-99)
      • conflict (102)
      • conflict (105-106)
      • conflict (115)
      • conflict (117)
      • conflict (155)
      • conflict (166)
    Domains in SCOPe 2.03: d1mcsa1, d1mcsa2
  • Chain 'B':
    Compound: immunoglobulin lambda dimer mcg (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR S14675 (1-215)
      • conflict (19)
      • conflict (22)
      • conflict (28)
      • conflict (30)
      • conflict (38)
      • conflict (41)
      • conflict (47-48)
      • conflict (53)
      • conflict (61)
      • conflict (93)
      • conflict (96-99)
      • conflict (102)
      • conflict (105-106)
      • conflict (115)
      • conflict (117)
      • conflict (155)
      • conflict (166)
    Domains in SCOPe 2.03: d1mcsb1, d1mcsb2
  • Chain 'P':
    Compound: peptide n-acetyl-l-gln-d-phe-l-his-d-pro-oh
    Database cross-references and differences (RAF-indexed):
    • PDB 1MCS (Start-3)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcsA (A:)
    psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcsB (B:)
    psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'P':
    No sequence available.