PDB entry 1mcp

View 1mcp on RCSB PDB site
Description: phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1984-07-09, released 1985-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.225
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: iga-kappa mcpc603 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mcph1, d1mcph2
  • Chain 'L':
    Compound: iga-kappa mcpc603 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA72671 (0-219)
      • conflict (111)
    Domains in SCOPe 2.07: d1mcpl1, d1mcpl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcpH (H:)
    evklvesggglvqpggslrlscatsgftfsdfymewvrqppgkrlewiaasrnkgnkytt
    eysasvkgrfivsrdtsqsilylqmnalraedtaiyycarnyygstwyfdvwgagttvtv
    ssesarnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppala
    sggrytmsnqltlpavecpegesvkcsvqhdsnpvqeldvnc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcpL (L:)
    divmtqspsslsvsagervtmsckssqsllnsgnqknflawyqqkpgqppklliygastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtkleikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec