PDB entry 1mco

View 1mco on RCSB PDB site
Description:
Deposited on 1993-02-25, released 1994-01-31
The last revision prior to the SCOP 1.69 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3.2 Å
R-factor: 0.232
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcoH (H:)
    plvlqesgpglvkpsealsltctvsgdsintilyywswirqppgkglewigyiyysgsty
    gnpslksrvtisvntsknqfysklssvtaadtavyycarvplvvnpwgqgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkrvapellggpsvflfppkpkdtlmisr
    tpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqynstyrvvsvltvlhqnwld
    gkeykckvsnkalpapiektiskakgqprepqvytlppsreemtknqvsltclvkgfyps
    diavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnh
    ytqkslsl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcoL (L:)
    psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatevclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs