PDB entry 1mcl

View 1mcl on RCSB PDB site
Description: principles and pitfalls in designing site directed peptide ligands
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-02-25, released 1994-01-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.189
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin lambda dimer mcg (light chain)
    Domains in SCOPe 2.03: d1mcla1, d1mcla2
  • Chain 'B':
    Compound: immunoglobulin lambda dimer mcg (light chain)
    Domains in SCOPe 2.03: d1mclb1, d1mclb2
  • Chain 'P':
    Compound: n-acetyl-d-his-l-pro-oh

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mclA (A:)
    psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mclB (B:)
    psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'P':
    No sequence available.