PDB entry 1mcb

View 1mcb on RCSB PDB site
Description: principles and pitfalls in designing site directed peptide ligands
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-02-25, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin lambda dimer mcg (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PIK1 (1-215)
      • insertion (0)
      • conflict (13)
      • conflict (41)
      • conflict (47-48)
      • conflict (93)
      • conflict (96)
      • conflict (98)
    Domains in SCOPe 2.07: d1mcba1, d1mcba2
  • Chain 'B':
    Compound: immunoglobulin lambda dimer mcg (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PIK1 (1-215)
      • insertion (0)
      • conflict (13)
      • conflict (41)
      • conflict (47-48)
      • conflict (93)
      • conflict (96)
      • conflict (98)
    Domains in SCOPe 2.07: d1mcbb1, d1mcbb2
  • Chain 'P':
    Compound: peptide n-acetyl-l-gln-d-phe-l-his-d-pro-oh
    Database cross-references and differences (RAF-indexed):
    • PDB 1MCB (Start-3)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcbA (A:)
    psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcbB (B:)
    psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'P':
    No sequence available.