PDB entry 1mc8

View 1mc8 on RCSB PDB site
Description: Crystal Structure of Flap Endonuclease-1 R42E mutant from Pyrococcus horikoshii
Class: hydrolase
Keywords: flexible loop, HYDROLASE
Deposited on 2002-08-06, released 2002-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.19
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flap Endonuclease-1
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O50123
      • engineered (41)
    Domains in SCOPe 2.07: d1mc8a1, d1mc8a2
  • Chain 'B':
    Compound: Flap Endonuclease-1
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O50123
      • engineered (41)
    Domains in SCOPe 2.07: d1mc8b1, d1mc8b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mc8A (A:)
    mgvpigdlvprkeidlenlygkkiaidalnaiyqflstirqedgtplmdskgritshlsg
    lfyrtinlmeagikpayvfdgkppefkrkelekrreareeaelkwkealakgnleearky
    aqratkvnemliedakkllqlmgipiiqapsegeaqaaymaskgdvyasasqdydsllfg
    aprlirnltitgkrkmpgkdvyveikpelvvldevlkelkitreklielailvgtdynpg
    gvkgigpkkaleivrysrdplakfqrqsdvdlyaikefflnppvtneyslswkepdeegi
    lkflcdehnfseervkngierlkkaikagrqstleswfvkkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mc8A (A:)
    gvpigdlvprkeidlenlygkkiaidalnaiyqflstirqedgtplmdskgritshlsgl
    fyrtinlmeagikpayvfdgkppefkrkelekrreareeaelkwkealakgnleearkya
    qratkvnemliedakkllqlmgipiiqapsegeaqaaymaskgdvyasasqdydsllfga
    prlirnltitgkrkmpgkdvyveikpelvvldevlkelkitreklielailvgtdynpgg
    vkgigpkkaleivrysrdplakfqrqsdvdlyaikefflnppvtneyslswkepdeegil
    kflcdehnfseervkngierlkkaikagrqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mc8B (B:)
    mgvpigdlvprkeidlenlygkkiaidalnaiyqflstirqedgtplmdskgritshlsg
    lfyrtinlmeagikpayvfdgkppefkrkelekrreareeaelkwkealakgnleearky
    aqratkvnemliedakkllqlmgipiiqapsegeaqaaymaskgdvyasasqdydsllfg
    aprlirnltitgkrkmpgkdvyveikpelvvldevlkelkitreklielailvgtdynpg
    gvkgigpkkaleivrysrdplakfqrqsdvdlyaikefflnppvtneyslswkepdeegi
    lkflcdehnfseervkngierlkkaikagrqstleswfvkkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mc8B (B:)
    gvpigdlvprkeidlenlygkkiaidalnaiyqflstirqedgtplmdskgritshlsgl
    fyrtinlmeagikpayvfdgkppefkrkelekrreareeaelkwkealakgnleearkya
    qratkvnemliedakkllqlmgipiiqapsegeaqaaymaskgdvyasasqdydsllfga
    prlirnltitgkrkmpgkdvyveikpelvvldevlkelkitreklielailvgtdynpgg
    vkgigpkkaleivrysrdplakfqrqsdvdlyaikefflnppvtneyslswkepdeegil
    kflcdehnfseervkngierlkkaikagrqs