PDB entry 1mc5

View 1mc5 on RCSB PDB site
Description: Ternary complex of Human glutathione-dependent formaldehyde dehydrogenase with S-(hydroxymethyl)glutathione and NADH
Class: oxidoreductase
Keywords: glutathione-dependent formaldehyde dehydrogenase, Class III alcohol dehydrogenase, s-(hydroxymethyl)glutathione, OXIDOREDUCTASE
Deposited on 2002-08-05, released 2003-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.197
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alcohol dehydrogenase class III chi chain
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mc5a1, d1mc5a2
  • Chain 'B':
    Compound: Alcohol dehydrogenase class III chi chain
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mc5b1, d1mc5b2
  • Heterogens: ZN, K, PO4, NAD, AHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mc5A (A:)
    manevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegc
    fpvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgk
    glmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgy
    gaavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgatec
    inpqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgee
    iatrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafe
    lmhsgksirtvvki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mc5A (A:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mc5B (B:)
    manevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegc
    fpvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgk
    glmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgy
    gaavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgatec
    inpqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgee
    iatrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafe
    lmhsgksirtvvki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mc5B (B:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki