PDB entry 1mc2

View 1mc2 on RCSB PDB site
Description: monomeric lys-49 phospholipase a2 homologue purified from ag
Deposited on 2002-08-05, released 2002-08-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-02-24, with a file datestamp of 2004-02-24.
Experiment type: XRAY
Resolution: 0.85 Å
R-factor: 0.104
AEROSPACI score: 1.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1mc2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mc2A (A:)
    slfelgkmiwqetgknpvknyglygcncgvggrgepldatdrccfvhkccykkltdcdsk
    kdrysykwknkaivcgknqpcmqemcecdkafaiclrenldtynksfryhlkpsckktse
    qc