PDB entry 1mc1

View 1mc1 on RCSB PDB site
Description: beta-lactam synthetase with product (dgpc), amp and ppi
Deposited on 2002-08-04, released 2002-10-23
The last revision prior to the SCOP 1.67 freeze date was dated 2002-12-18, with a file datestamp of 2002-12-18.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.208
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mc1A (A:)
    mgapvlpaafgflasartgggrapgpvfatrgshtdidtpqgerslaatlvhapsvapdr
    avarsltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngr
    fatvvrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvag
    ltgvyqvpagavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtp
    gdtplvvlsggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreiti
    pttellaqlpyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhre
    drlpaldtvlahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhg
    rdkwvlraamadalpaetvnrpklgvhegsgttssfsrllldhgvaedrvheakrqvvre
    lfdltvgggrhpsevdtddvvrsvadrtargaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mc1A (A:)
    vlpaafgflasargpvfatrgshtdidtpqgerslaatlvhapsvapdravarsltgapt
    tavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfatvvrtgdrv
    llatdhagsvplytcvapgevrasteakalaagfpladarrvagltgvyqvpagavmdid
    lgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtpgdtplvvlsggidssg
    vaacahraageldtvsmgtdtsnefrearavvdhlrtrhreitipttellaqlpyavwas
    esvdpdiieyllpltalyraldgperriltgygadiplggmhredrlpaldtvlahdmat
    fdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhgrdkwvlraamadalpa
    etvnrpklgvhegsgttssfsrllldhgvaedrvheakrqvvrelfdltvgggrhpsevd
    tddvvrsvadr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mc1B (B:)
    mgapvlpaafgflasartgggrapgpvfatrgshtdidtpqgerslaatlvhapsvapdr
    avarsltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngr
    fatvvrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvag
    ltgvyqvpagavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtp
    gdtplvvlsggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreiti
    pttellaqlpyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhre
    drlpaldtvlahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhg
    rdkwvlraamadalpaetvnrpklgvhegsgttssfsrllldhgvaedrvheakrqvvre
    lfdltvgggrhpsevdtddvvrsvadrtargaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mc1B (B:)
    apvlpaafgflasartgggrapgpvfatrgshtdidtpqgerslaatlvhapsvapdrav
    arsltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfa
    tvvrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvaglt
    gvyqvpagavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtpgd
    tplvvlsggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreitipt
    tellaqlpyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhredr
    lpaldtvlahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhgrd
    kwvlraamadalpaetvnrpkltssfsrllldhgvaedrvheakrqvvrelfdltvgggr
    hpsevdtddvvrsvadrt