PDB entry 1mbz

View 1mbz on RCSB PDB site
Description: beta-lactam synthetase with trapped intermediate
Deposited on 2002-08-04, released 2002-10-23
The last revision prior to the SCOP 1.67 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.214
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mbzA (A:)
    mgapvlpaafgflasartgggrapgpvfatrgshtdidtpqgerslaatlvhapsvapdr
    avarsltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngr
    fatvvrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvag
    ltgvyqvpagavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtp
    gdtplvvlsggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreiti
    pttellaqlpyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhre
    drlpaldtvlahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhg
    rdkwvlraamadalpaetvnrpklgvhegsgttssfsrllldhgvaedrvheakrqvvre
    lfdltvgggrhpsevdtddvvrsvadrtargaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mbzA (A:)
    apvlpaafgflasartggpvfatrgshtdidtpqgerslaatlvhapsvapdravarslt
    gapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfatvvrt
    gdrvllatdhagsvplytcvapgevrasteakalaahgfpladarrvagltgvyqvpaga
    vmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtpgdtplvvlsgg
    idssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreitipttellaqlpy
    avwasesvdpdiieyllpltalyraldgperriltgygadiplggmhredrlpaldtvla
    hdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhgrdkwvlraama
    dalpaetvnrpklgvhegsgttssfsrllldhgvaedrvheakrqvvrelfdltvgggrh
    psevdtddvvrsvadr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mbzB (B:)
    mgapvlpaafgflasartgggrapgpvfatrgshtdidtpqgerslaatlvhapsvapdr
    avarsltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngr
    fatvvrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvag
    ltgvyqvpagavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtp
    gdtplvvlsggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreiti
    pttellaqlpyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhre
    drlpaldtvlahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhg
    rdkwvlraamadalpaetvnrpklgvhegsgttssfsrllldhgvaedrvheakrqvvre
    lfdltvgggrhpsevdtddvvrsvadrtargaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mbzB (B:)
    apvlpaafgflasartgggpvfatrgshtdidtpqgerslaatlvhapsvapdravarsl
    tgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfatvvr
    tgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvagltgvyq
    vpagavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtpgdtplv
    vlsggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreitipttell
    aqlpyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhredrlpal
    dtvlahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhgrdkwvl
    raamadalpaetvnrpkltssfsrllldhgvaedrvheakrqvvrelfdltvgggrhpse
    vdtddvvrsvadrt