PDB entry 1mbs

View 1mbs on RCSB PDB site
Description: x-ray crystallographic studies of seal myoglobin. the molecule at 2.5 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1979-03-22, released 1979-05-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Phoca vitulina [TaxId:9720]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02162 (0-152)
  Domains in SCOPe 2.03: d1mbsa_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mbsA (A:)
  glsdgewhlvlnvwgkvetdlaghgqevlirlfkshpetlekfdkfkhlkseddmrrsed
  lrkhgntvltalggilkkkghheaelkplaqshatkhkipikylefiseaiihvlhskhp
  aefgadaqaamkkalelfrndiaakykelgfhg