PDB entry 1mbs

View 1mbs on RCSB PDB site
Description: x-ray crystallographic studies of seal myoglobin. the molecule at 2.5 angstroms resolution
Deposited on 1979-03-22, released 1979-05-15
The last revision prior to the SCOP 1.69 freeze date was dated 1983-09-30, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1mbs__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbs_ (-)
    glsdgewhlvlnvwgkvetdlaghgqevlirlfkshpetlekfdkfkhlkseddmrrsed
    lrkhgntvltalggilkkkghheaelkplaqshatkhkipikylefiseaiihvlhskhp
    aefgadaqaamkkalelfrndiaakykelgfhg