PDB entry 1mbs

View 1mbs on RCSB PDB site
Description: x-ray crystallographic studies of seal myoglobin. the molecule at 2.5 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1979-03-22, released 1979-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Phoca vitulina [TaxId:9720]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mbsa_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbsA (A:)
    glsdgewhlvlnvwgkvetdlaghgqevlirlfkshpetlekfdkfkhlkseddmrrsed
    lrkhgntvltalggilkkkghheaelkplaqshatkhkipikylefiseaiihvlhskhp
    aefgadaqaamkkalelfrndiaakykelgfhg