PDB entry 1mbq

View 1mbq on RCSB PDB site
Description: Anionic Trypsin from Pacific Chum Salmon
Class: hydrolase
Keywords: psychrophilic enzymes, proteinase-catalyzed peptide coupling, HYDROLASE
Deposited on 2002-08-03, released 2002-12-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.166
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Oncorhynchus keta [TaxId:8018]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mbqa_
  • Heterogens: CA, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbqA (A:)
    ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
    seqfisssrvirhpnyssynidndimliklsksatlntyvqpvalpsscapagtmctvsg
    wgntmsstadknklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
    vcngelqgvvswgygcaepgnpgvyakvcifndwltstma