PDB entry 1mbo

View 1mbo on RCSB PDB site
Description: Structure and refinement of oxymyoglobin at 1.6 angstroms resolution
Deposited on 1981-08-27, released 1982-02-03
The last revision prior to the SCOP 1.55 freeze date was dated 1983-09-30, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1mbo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbo_ (-)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg