PDB entry 1mbn

View 1mbn on RCSB PDB site
Description: the stereochemistry of the protein myoglobin
Deposited on 1973-04-05, released 1976-05-19
The last revision prior to the SCOP 1.67 freeze date was dated 1983-10-27, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1mbn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mbn_ (-)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg