PDB entry 1mbm

View 1mbm on RCSB PDB site
Description: nsp4 proteinase from equine arteritis virus
Deposited on 2002-08-03, released 2002-10-23
The last revision prior to the SCOP 1.69 freeze date was dated 2002-10-23, with a file datestamp of 2002-10-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1mbma_
  • Chain 'B':
    Domains in SCOP 1.69: d1mbmb_
  • Chain 'C':
    Domains in SCOP 1.69: d1mbmc_
  • Chain 'D':
    Domains in SCOP 1.69: d1mbmd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbmA (A:)
    kargnvgfvagssygtgsvwtrnnevvvltashvvgranmatlkigdamltltfkkngdf
    aeavttqselpgnwpqlhfaqpttgpaswctatgdeegllsgevclawttsgdsgsavvq
    gdavvgvhtgsntsgvayvttpsgkllgadtvtlsslskhftgpltsipkdipdniiadv
    davprslamlidglsnre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mbmB (B:)
    kargnvgfvagssygtgsvwtrnnevvvltashvvgranmatlkigdamltltfkkngdf
    aeavttqselpgnwpqlhfaqpttgpaswctatgdeegllsgevclawttsgdsgsavvq
    gdavvgvhtgsntsgvayvttpsgkllgadtvtlsslskhftgpltsipkdipdniiadv
    davprslamlidglsnre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mbmB (B:)
    kargnvgfvagssygtgsvwtrnnevvvltashvvgranmatlkigdamltltfkkngdf
    aeavttqselpgnwpqlhfaqpttgpaswctatgdeegllsgevclawttsgdsgsavvq
    gdavvgvhtgsntsgvayvttpsgkllgadtvtlsslskhftgpltsipkdipdniiadv
    davprslamlid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mbmC (C:)
    kargnvgfvagssygtgsvwtrnnevvvltashvvgranmatlkigdamltltfkkngdf
    aeavttqselpgnwpqlhfaqpttgpaswctatgdeegllsgevclawttsgdsgsavvq
    gdavvgvhtgsntsgvayvttpsgkllgadtvtlsslskhftgpltsipkdipdniiadv
    davprslamlidglsnre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mbmC (C:)
    kargnvgfvagssygtgsvwtrnnevvvltashvvgranmatlkigdamltltfkkngdf
    aeavttqselpgnwpqlhfaqpttgpaswctatgdeegllsgevclawttsgdsgsavvq
    gdavvgvhtgsntsgvayvttpsgkllgadtvtlsslskhftgpltsipkdipdniiadv
    davprslamli
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mbmD (D:)
    kargnvgfvagssygtgsvwtrnnevvvltashvvgranmatlkigdamltltfkkngdf
    aeavttqselpgnwpqlhfaqpttgpaswctatgdeegllsgevclawttsgdsgsavvq
    gdavvgvhtgsntsgvayvttpsgkllgadtvtlsslskhftgpltsipkdipdniiadv
    davprslamlidglsnre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mbmD (D:)
    rgnvgfvagssygtgsvwtrnnevvvltashvvgranmatlkigdamltltfkkngdfae
    avttqselpgnwpqlhfaqpttgpaswctatgdeegllsgevclawttsgdsgsavvqgd
    avvgvhtgsntsgvayvttpsgkllgadtvtlsslskhftgpltsipkdipdniiadvda
    vprslamlidglsnr