PDB entry 1mbj

View 1mbj on RCSB PDB site
Description: mouse c-myb dna-binding domain repeat 3
Deposited on 1995-05-19, released 1995-07-31
The last revision prior to the SCOP 1.65 freeze date was dated 1995-07-31, with a file datestamp of 1995-08-14.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1mbj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbj_ (-)
    vkktswteeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv