PDB entry 1mbh

View 1mbh on RCSB PDB site
Description: mouse c-myb dna-binding domain repeat 2
Deposited on 1995-05-19, released 1995-09-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: NMR50
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1mbh__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbh_ (-)
    likgpwtkeedqrvielvqkygpkrwsviakhlkgrigkqcrerwhnhlnpe