PDB entry 1mbd

View 1mbd on RCSB PDB site
Description: neutron diffraction reveals oxygen-histidine hydrogen bond in oxymyoglobin
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1981-08-27, released 1982-02-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mbda_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbdA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg