PDB entry 1mbc

View 1mbc on RCSB PDB site
Description: x-ray structure and refinement of carbon-monoxy (fe ii)-myoglobin at 1.5 angstroms resolution
Deposited on 1988-09-15, released 1989-01-09
The last revision prior to the SCOP 1.67 freeze date was dated 1989-01-09, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.171
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1mbc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbc_ (-)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg