PDB entry 1mb9

View 1mb9 on RCSB PDB site
Description: beta-lactam synthetase complexed with atp
Deposited on 2002-08-02, released 2002-10-23
The last revision prior to the SCOP 1.65 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.21
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mb9A (A:)
    mgapvlpaafgflasartgggrapgpvfatrgshtdidtpqgerslaatlvhapsvapdr
    avarsltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngr
    fatvvrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvag
    ltgvyqvpagavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtp
    gdtplvvlsggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreiti
    pttellaqlpyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhre
    drlpaldtvlahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhg
    rdkwvlraamadalpaetvnrpklgvhegsgttssfsrllldhgvaedrvheakrqvvre
    lfdltvgggrhpsevdtddvvrsvadrtargaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mb9A (A:)
    pvlpaafgflasartgapgpvfatrgshtdidtpqgerslaatlvhapsvapdravarsl
    tgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfatvvr
    tgdrvllatdhagsvplytcvapgevrasteakalaafpladarrvagltgvyqvpagav
    mdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtpgdtplvvlsggi
    dssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreitipttellaqlpya
    vwasesvdpdiieyllpltalyraldgperriltgygadiplggmhredrlpaldtvlah
    dmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhgrdkwvlraamad
    alpaetvnrpkssfsrllldhgvaedrvheakrqvvrelfdltvgggrhpsevdtddvvr
    svadr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mb9B (B:)
    mgapvlpaafgflasartgggrapgpvfatrgshtdidtpqgerslaatlvhapsvapdr
    avarsltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngr
    fatvvrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvag
    ltgvyqvpagavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtp
    gdtplvvlsggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreiti
    pttellaqlpyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhre
    drlpaldtvlahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhg
    rdkwvlraamadalpaetvnrpklgvhegsgttssfsrllldhgvaedrvheakrqvvre
    lfdltvgggrhpsevdtddvvrsvadrtargaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mb9B (B:)
    apvlpaafgflasartggpgpvfatrgshtdidtpqgerslaatlvhapsvapdravars
    ltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfatvv
    rtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvagltgvy
    qvpagavmdidlgsgtavthrtwtpglsrrilpegeavaavraalekavaqrvtpgdtpl
    vvlsggidssgvaacahraageldtvsmgtdtsnefrearavvdhlrtrhreitipttel
    laqlpyavwasesvdpdiieyllpltalyraldgperriltgygadiplggmhredrlpa
    ldtvlahdmatfdglnemspvlstlaghwtthpywdrevldllvsleaglkrrhgrdkwv
    lraamadalpaetvnrpklgttssfsrllldhgvaedrvheakrqvvrelfdltvgggrh
    psevdtddvvrsvadrt