PDB entry 1mb8

View 1mb8 on RCSB PDB site
Description: Crystal Structure of the actin binding domain of plectin
Class: Structural protein
Keywords: calponin homology domain, actin binding domain, integrin beta4 hemidesmosomes, cytoskeleton, epidermolysis bullosa
Deposited on 2002-08-02, released 2003-06-10
The last revision prior to the SCOP 1.73 freeze date was dated 2003-06-10, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.212
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plectin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15149 (3-242)
      • cloning artifact (0-2)
      • see remark 999 (29)
      • see remark 999 (29)
      • see remark 999 (29)
      • see remark 999 (29)
      • see remark 999 (29)
      • see remark 999 (98)
    Domains in SCOP 1.73: d1mb8a1, d1mb8a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mb8A (A:)
    shmaviriaderdrvqkktftkwvnkhlikhwraeaqrhisdlyedlrdghnlisllevl
    sgdslprekgrmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilh
    fqisdiqvsgqsedmtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhkpl
    lidmnkvyrqtnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamp
    rvp