PDB entry 1mb4

View 1mb4 on RCSB PDB site
Description: Crystal structure of aspartate semialdehyde dehydrogenase from vibrio cholerae with NADP and S-methyl-l-cysteine sulfoxide
Class: oxidoreductase
Keywords: enzyme, aspartate-semialdehyde dehydrogenase, complex, vibrio cholerae, OXIDOREDUCTASE
Deposited on 2002-08-02, released 2003-01-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.192
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Vibrio cholerae [TaxId:666]
    Gene: ASD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mb4a1, d1mb4a2
  • Chain 'B':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Vibrio cholerae [TaxId:666]
    Gene: ASD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mb4b1, d1mb4b2
  • Heterogens: CYS, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mb4A (A:)
    mrvglvgwrgmvgsvlmqrmveerdfdliepvffstsqigvpapnfgkdagmlhdafdie
    slkqldavitcqggsytekvypalrqagwkgywidaastlrmdkeaiitldpvnlkqilh
    gihhgtktfvggnctvslmlmalgglyerglvewmsamtyqaasgagaqnmrelisqmgv
    indavsselanpassildidkkvaetmrsgsfptdnfgvplagslipwidvkrdngqske
    ewkagveankilglqdspvpidgtcvrigamrchsqaltiklkqnipldeieemiathnd
    wvkvipnerditareltpakvtgtlsvpvgrlrkmamgddflnaftvgdqllwgaaeplr
    rtlriilaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mb4A (A:)
    mrvglvgwrgmvgsvlmqrmveerdfdliepvffstsqigvpapnfgkdagmlhdafdie
    slkqldavitcqggsytekvypalrqagwkgywidaastlrmdkeaiitldpvnlkqilh
    gihhgtktfvggnctvslmlmalgglyerglvewmsamtyqaasgagaqnmrelisqmgv
    indavsselanpassildidkkvaetmrsgsfptdnfgvplagslipwidvkrdngqske
    ewkagveankilglqdspvpidgtcvrigamrchsqaltiklkqnipldeieemiathnd
    wvkvipnerditareltpakvtgtlsvpvgrlrkmamgddflnaftvgdqllwgaaeplr
    rtlriilae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mb4B (B:)
    mrvglvgwrgmvgsvlmqrmveerdfdliepvffstsqigvpapnfgkdagmlhdafdie
    slkqldavitcqggsytekvypalrqagwkgywidaastlrmdkeaiitldpvnlkqilh
    gihhgtktfvggnctvslmlmalgglyerglvewmsamtyqaasgagaqnmrelisqmgv
    indavsselanpassildidkkvaetmrsgsfptdnfgvplagslipwidvkrdngqske
    ewkagveankilglqdspvpidgtcvrigamrchsqaltiklkqnipldeieemiathnd
    wvkvipnerditareltpakvtgtlsvpvgrlrkmamgddflnaftvgdqllwgaaeplr
    rtlriilaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mb4B (B:)
    mrvglvgwrgmvgsvlmqrmveerdfdliepvffstsqigvpapnfgkdagmlhdafdie
    slkqldavitcqggsytekvypalrqagwkgywidaastlrmdkeaiitldpvnlkqilh
    gihhgtktfvggnctvslmlmalgglyerglvewmsamtyqaasgagaqnmrelisqmgv
    indavsselanpassildidkkvaetmrsgsfptdnfgvplagslipwidvkrdngqske
    ewkagveankilglqdspvpidgtcvrigamrchsqaltiklkqnipldeieemiathnd
    wvkvipnerditareltpakvtgtlsvpvgrlrkmamgddflnaftvgdqllwgaaeplr
    rtlriilae