PDB entry 1maz

View 1maz on RCSB PDB site
Description: x-ray structure of bcl-xl, an inhibitor of programmed cell death
Deposited on 1996-04-09, released 1997-04-21
The last revision prior to the SCOP 1.69 freeze date was dated 1997-04-21, with a file datestamp of 1997-04-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1maz__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1maz_ (-)
    msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnps
    whladspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitp
    gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
    hlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1maz_ (-)
    msqsnrelvvdflsyklsqkgyswsqfipmaavkqalreagdefelryrrafsdltsqlh
    itpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmaty
    lndhlepwiqenggwdtfvelyg