PDB entry 1maw

View 1maw on RCSB PDB site
Description: crystal structure of tryptophanyl-trna synthetase complexed with atp in an open conformation
Deposited on 2002-08-02, released 2003-01-07
The last revision prior to the SCOP 1.71 freeze date was dated 2003-01-07, with a file datestamp of 2003-01-07.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.218
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1mawa_
  • Chain 'B':
    Domains in SCOP 1.71: d1mawb_
  • Chain 'C':
    Domains in SCOP 1.71: d1mawc_
  • Chain 'D':
    Domains in SCOP 1.71: d1mawd_
  • Chain 'E':
    Domains in SCOP 1.71: d1mawe_
  • Chain 'F':
    Domains in SCOP 1.71: d1mawf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mawA (A:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mawA (A:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mawB (B:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mawB (B:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mawC (C:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mawC (C:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mawD (D:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mawD (D:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1mawE (E:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mawE (E:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1mawF (F:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mawF (F:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgr