PDB entry 1mau

View 1mau on RCSB PDB site
Description: Crystal structure of Tryptophanyl-tRNA Synthetase Complexed with ATP and Tryptophanamide in a Pre-Transition state Conformation
Class: ligase
Keywords: Amino-acyl tRNA synthetase, Rossmann fold, atp binding site, pre-transition state
Deposited on 2002-08-02, released 2003-01-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-01-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan-tRNA ligase
    Species: Bacillus stearothermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1maua_
  • Heterogens: NA, MG, ATP, LTN, CIT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mauA (A:)
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgrrr