PDB entry 1mau

View 1mau on RCSB PDB site
Description: crystal structure of tryptophanyl-trna synthetase complexed with atp and tryptophanamide in a pre-transition state conformation
Deposited on 2002-08-02, released 2003-01-07
The last revision prior to the SCOP 1.67 freeze date was dated 2003-01-07, with a file datestamp of 2003-01-07.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1maua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mauA (A:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgrrr