PDB entry 1mat

View 1mat on RCSB PDB site
Description: structure of the cobalt-dependent methionine aminopeptidase from escherichia coli: a new type of proteolytic enzyme
Class: hydrolase(alpha-aminoacylpeptide)
Keywords: hydrolase(alpha-aminoacylpeptide)
Deposited on 1992-12-02, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.182
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionyl aminopeptidase
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1mata_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1matA (A:)
    maisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsacl
    gyhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkpti
    mgerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfhee
    pqvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivv
    tdngceiltlrkddtipaiishde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1matA (A:)
    aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
    yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
    gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
    qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
    dngceiltlrkddtipaiishde