PDB entry 1mas

View 1mas on RCSB PDB site
Description: purine nucleoside hydrolase
Class: hydrolase
Keywords: hydrolase, purine nucleoside hydrolase, purine nucleosidase, iu-nh
Deposited on 1995-12-18, released 1996-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.17
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inosine-uridine nucleoside n-ribohydrolase
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Gene: IU-NH FROM C.FASCICULATA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1masa_
  • Chain 'B':
    Compound: inosine-uridine nucleoside n-ribohydrolase
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Gene: IU-NH FROM C.FASCICULATA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1masb_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1masA (A:)
    akkiildcdpglddavaillahgnpeiellaittvvgnqtlakvtrnaqlvadiagitgv
    piaagcdkplvrkimtaghihgesgmgtvaypaefknkvderhavnliidlvmshepkti
    tlvptggltniamaarleprivdrvkevvlmgggyhegnatsvaefniiidpeaahivfn
    eswqvtmvgldlthqalatppilqrvkevdtnparfmleimdyytkiyqsnrymaaaavh
    dpcavayvidpsvmttervpvdieltgkltlgmtvadfrnprpehchtqvavkldfekfw
    glvldalerigdpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1masA (A:)
    akkiildcdpglddavaillahgnpeiellaittvvgnqtlakvtrnaqlvadiagitgv
    piaagcdkplvrkimtesgmgtvaypaefknkvderhavnliidlvmshepktitlvptg
    gltniamaarleprivdrvkevvlmgggyhegnatsvaefniiidpeaahivfneswqvt
    mvgldlthqalatppilqrvkevdtnparfmleimdyytkiyqsnrymaaaavhdpcava
    yvidpsvmttervpvdieltgkltlgmtvadfrnprpehchtqvavkldfekfwglvlda
    lerigdpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1masB (B:)
    akkiildcdpglddavaillahgnpeiellaittvvgnqtlakvtrnaqlvadiagitgv
    piaagcdkplvrkimtaghihgesgmgtvaypaefknkvderhavnliidlvmshepkti
    tlvptggltniamaarleprivdrvkevvlmgggyhegnatsvaefniiidpeaahivfn
    eswqvtmvgldlthqalatppilqrvkevdtnparfmleimdyytkiyqsnrymaaaavh
    dpcavayvidpsvmttervpvdieltgkltlgmtvadfrnprpehchtqvavkldfekfw
    glvldalerigdpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1masB (B:)
    akkiildcdpglddavaillahgnpeiellaittvvgnqtlakvtrnaqlvadiagitgv
    piaagcdkplvrkimtknkvderhavnliidlvmshepktitlvptggltniamaarlep
    rivdrvkevvlmgggyhegnatsvaefniiidpeaahivfneswqvtmvgldlthqalat
    ppilqrvkevdtnparfmleimdyytkiyqsnrymaaaavhdpcavayvidpsvmtterv
    pvdieltgkltlgmtvadfrnprpehchtqvavkldfekfwglvldalerigdpq