PDB entry 1mam

View 1mam on RCSB PDB site
Description: crystal structure to 2.45 a resolution of a monoclonal fab specific for the brucella a cell wall polysaccharide antigen
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1992-01-14, released 1993-10-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.215
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2b-kappa yst9.1 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1mamh1, d1mamh2
  • Chain 'L':
    Compound: igg2b-kappa yst9.1 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MAM (0-213)
    Domains in SCOPe 2.03: d1maml1, d1maml2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mamH (H:)
    evklvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkadgytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyyctrdpygpaaywgqgtlvtvsaa
    kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl
    ytmsssvtvpsstwpsqtvtcsvahpassttvdkkle
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mamL (L:)
    diqmtqttsslsaslgdrvtiscrasqdiynylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnlnqedmatyicqqgntlpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec