PDB entry 1mai

View 1mai on RCSB PDB site
Description: structure of the pleckstrin homology domain from phospholipase c delta in complex with inositol trisphosphate
Deposited on 1996-05-23, released 1996-11-08
The last revision prior to the SCOP 1.61 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1mai__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mai_ (-)
    glqddpdlqallkgsqllkvkssswrrerfyklqedcktiwqesrkvmrspesqlfsied
    iqevrmghrteglekfardipedrcfsivfkdqrntldliapspadaqhwvqglrkiih