PDB entry 1maf

View 1maf on RCSB PDB site
Description: The Active Site Structure of Methylamine Dehydrogenase: Hydrazines Identify C6 as the Reactive Site of the Tryptophan Derived Quinone Cofactor
Deposited on 1992-05-20, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.188
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.55: d1mafh_
  • Chain 'L':
    Domains in SCOP 1.55: d1mafl_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mafH (H:)
    ssasaaaaaaaaalaagaadgptndeapgadgrrsyinlpahhsaiiqqwvldagsgsil
    ghvnggflpnpvaahsgsefalastsfsriakgkrtdyvevfdpvtflpiadielpdapr
    fdvgpyswmnantpnnadllffqfaagpavglvvqggssddqllssptcyhihpgapstf
    yllcaqgglaktdhaggaagaglvgamltaaqnlltqpaqanksgrivwpvysgkilqad
    isaagatnkapidalsggrkadtwrpggwqqvaylkssdgiylltseqsawklhaaakev
    tsvtglvgqtssqislghdvdaisvaqdggpdlyalsagtevlhiydagagdqdqstvel
    gsgpqvlsvmnea
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mafL (L:)
    vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgka