PDB entry 1mae

View 1mae on RCSB PDB site
Description: The Active Site Structure of Methylamine Dehydrogenase: Hydrazines Identify C6 as the Reactive Site of the Tryptophan Derived Quinone Cofactor
Class: oxidoreductase(chnh2(d)-deaminating)
Keywords: oxidoreductase(chnh2(d)-deaminating)
Deposited on 1992-05-20, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.183
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: methylamine dehydrogenase (heavy subunit)
    Species: PARACOCCUS VERSUTUS [TaxId:34007]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1maeh_
  • Chain 'L':
    Compound: methylamine dehydrogenase (light subunit)
    Species: PARACOCCUS VERSUTUS [TaxId:34007]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mael_
  • Heterogens: HDZ, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1maeH (H:)
    ssasaaaaaaaaalaagaadgptndeapgadgrrsyinlpahhsaiiqqwvldagsgsil
    ghvnggflpnpvaahsgsefalastsfsriakgkrtdyvevfdpvtflpiadielpdapr
    fdvgpyswmnantpnnadllffqfaagpavglvvqggssddqllssptcyhihpgapstf
    yllcaqgglaktdhaggaagaglvgamltaaqnlltqpaqanksgrivwpvysgkilqad
    isaagatnkapidalsggrkadtwrpggwqqvaylkssdgiylltseqsawklhaaakev
    tsvtglvgqtssqislghdvdaisvaqdggpdlyalsagtevlhiydagagdqdqstvel
    gsgpqvlsvmnea
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1maeL (L:)
    vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgka