PDB entry 1mab

View 1mab on RCSB PDB site
Description: rat liver f1-ATPase
Class: hydrolase
Keywords: ATP synthase, fof1-ATPase, oxidative phosphorylation, mitochondria, hydrolase
Deposited on 1998-08-06, released 1998-09-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: -1.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (f1-ATPase alpha chain)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1maba1, d1maba2, d1maba3
  • Chain 'B':
    Compound: protein (f1-ATPase beta chain)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mabb1, d1mabb2, d1mabb3
  • Chain 'G':
    Compound: protein (f1-ATPase gamma chain)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35435 (0-269)
      • conflict (0)
    Domains in SCOPe 2.05: d1mabg_
  • Heterogens: PO4, MG, ATP, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mabA (A:)
    qktgtaemssileerilgadtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglk
    gmslnlepdnvgvvvfgndklikegdivkrtgaivdvpvgdellgrvvdalgnaidgkgp
    vgskirrrvglkapgiiprisvrepmqtgikavdslvpigrgqreliigdrqtgktsiai
    dtiinqkrfndgtdekkklyciyvaigqkrstvaqlvkrltdadamkytivvsatasdaa
    plqylapysgcsmgeyfrdngkhaliiyddlskqavayrqmslllrrppgreaypgdvfy
    lhsrlleraakmndsfgggsltalpvietqagdvsayiptnvisitdgqifletelfykg
    irpainvglsvsrvgsaaqtramkqvagtmklelaqyrevaafaqfgsdldaatqqllsr
    gvrltellkqgqyspmaieeqvaviyagvrgyldklepskitkfesaflshvvsqhqsll
    gnirtdgkiseqsdaklkeivtnflagfep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mabA (A:)
    ssileerigadtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepd
    nvgvvvfgndklikegdivkrtgaivdvpvgdellgrvvdalgnaidgkgpvgskirrrv
    glkapgiiprisvrepmqtgikavdslvpigrgqreliigdrqtgktsiaidtiinqkrf
    ndgtdekkklyciyvaigqkrstvaqlvkrltdadamkytivvsatasdaaplqylapys
    gcsmgeyfrdngkhaliiyddlskqavayrqmslllrrppgreaypgdvfylhsrllera
    akmndsfgggsltalpvietqagdvsayiptnvisitdgqifletelfykgirpainvgl
    svsrvgsaaqtramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellk
    qgqyspmaieeqvaviyagvrgyldklepskitkfesaflshvvsqhqsllgnirtdgki
    seqsdaklkeivtnflagfep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mabB (B:)
    saapkagtatgqivavigavvdvqfdeglppilnalevqgresrlvlevaqhlgestvrt
    iamdgteglvrgqkvldsgapikipvgpetlgrimnvigepidergpiktkqfapihaea
    pefiemsveqeilvtgikvvdllapyakggkiglfggagvgktvlimelinnvakahggy
    svfagvgertregndlyhemiesgvinlkdatskvalvygqmneppgararvaltgltva
    eyfrdqegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgtmqeritttk
    kgsitsvqaiyvpaddltdpapattfahldattvlsraiaelgiypavdpldstsrimdp
    nivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqpfqv
    aevftghmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeehgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mabB (B:)
    saapkagtatgqivavigavvdvqfdeglppilnalevqgresrlvlevaqhlgestvrt
    iamdgteglvrgqkvldsgapikipvgpetlgrimnvigepidergpiktkqfapihaea
    pefiemsveqeilvtgikvvdllapyakggkiglfggagvgktvlimelinnvakahggy
    svfagvgertregndlyhemiesgvinlkdatskvalvygqmneppgararvaltgltva
    eyfrdqegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgtmqeritttk
    kgsitsvqaiyvpaddltdpapattfahldattvlsraiaelgiypavdpldstsrimdp
    nivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqpfqv
    aevftghmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeeh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1mabG (G:)
    rditrrlksikniqkitksmkmvaaakyaraerelkparvygtgslalyekaeikgpedk
    kkhliigvssdrglcgaihssvakqmkndmaaltaagkevmivgigekiksilyrthsdq
    flvsfkdvgrkpptfgdasvialellnsgyefdegsiifnqfksvisykteekpifsfst
    vvaaenmsiyddidadvlqnyqeynlaniiyyslkesttseqsarmtamdnasknasdmi
    dkltltfnrtrqavitkelieiisgaaald
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mabG (G:)
    rditrrlksikniqkitksmkmvaaakyaraerelkparvygtgslcgaihssvakqmkl
    aniiyyslkesttseqsarmtamdnasknasdmidkltltfnrtrqavitkelieiisga
    aald