PDB entry 1ma3

View 1ma3 on RCSB PDB site
Description: Structure of a Sir2 enzyme bound to an acetylated p53 peptide
Deposited on 2002-07-31, released 2002-10-16
The last revision prior to the SCOP 1.71 freeze date was dated 2002-10-16, with a file datestamp of 2002-10-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ma3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ma3A (A:)
    medeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnp
    rafwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgs
    mdkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaiee
    akhcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlp
    kiveevkrlrsek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ma3A (A:)
    medeirkaaeilakskhavvftgagisaeglwrkydpeevasisgfkrnprafwefsmem
    kdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgsmdkldcldch
    etydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaieeakhcdafmvv
    gsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlpkiveevkrlr
    se