PDB entry 1ma0

View 1ma0 on RCSB PDB site
Description: Ternary complex of Human glutathione-dependent formaldehyde dehydrogenase with NAD+ and dodecanoic acid
Class: oxidoreductase
Keywords: human glutathione-dependent formaldehyde dehydrogenase, class III alcohol dehydrogenase, OXIDOREDUCTASE
Deposited on 2002-07-30, released 2002-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione-dependent formaldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ma0a1, d1ma0a2
  • Chain 'B':
    Compound: Glutathione-dependent formaldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ma0b1, d1ma0b2
  • Heterogens: ZN, K, PO4, NAD, DAO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ma0A (A:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ma0B (B:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki