PDB entry 1m9z

View 1m9z on RCSB PDB site
Description: crystal structure of human tgf-beta type II receptor ligand binding domain
Class: hormone/growth factor
Keywords: three finger toxin fold, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2002-07-30, released 2002-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TGF-beta receptor type II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37173 (0-End)
      • engineered (0)
      • engineered (71)
    Domains in SCOPe 2.08: d1m9za_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1m9zA (A:)
alckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchdpklpy
hdfiledaasptcimkekkkpgetffmcscssdecndniifseeyntsnpd

    Sequence, based on observed residues (ATOM records): (download) 
    >1m9zA (A:)
alckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchdpklpy
hdfiledaasptcimkekkkpgetffmcscssdecndniifseey