PDB entry 1m9u

View 1m9u on RCSB PDB site
Description: Crystal Structure of Earthworm Fibrinolytic Enzyme Component A from Eisenia fetida
Class: hydrolase
Keywords: hydrolase, serine protease (elastase-like), fibrinolytic enzyme
Deposited on 2002-07-29, released 2002-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Earthworm Fibrinolytic Enzyme
    Species: Eisenia fetida [TaxId:6396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m9ua_
  • Chain 'B':
    Compound: Earthworm Fibrinolytic Enzyme
    Species: Eisenia fetida [TaxId:6396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m9ub_
  • Chain 'C':
    Compound: Earthworm Fibrinolytic Enzyme
    Species: Eisenia fetida [TaxId:6396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m9uc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m9uA (A:)
    viggtnaspgefpwqlsqqrqsgswshscgasllsstsalsashcvdgvlpnnirviagl
    wqqsdtsgtqtanvdsytmhenygagtasysndiailhlatsislggniqaavlpannnn
    dyagttcvisgwgrtdgtnnlpdilqkssipvittaqctaamvgvgganiwdnhicvqdp
    agntgacngdsggplncpdggtrvvgvtswvvssglgaclpdypsvytrvsaylgwigdn
    s
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m9uB (B:)
    viggtnaspgefpwqlsqqrqsgswshscgasllsstsalsashcvdgvlpnnirviagl
    wqqsdtsgtqtanvdsytmhenygagtasysndiailhlatsislggniqaavlpannnn
    dyagttcvisgwgrtdgtnnlpdilqkssipvittaqctaamvgvgganiwdnhicvqdp
    agntgacngdsggplncpdggtrvvgvtswvvssglgaclpdypsvytrvsaylgwigdn
    s
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m9uC (C:)
    viggtnaspgefpwqlsqqrqsgswshscgasllsstsalsashcvdgvlpnnirviagl
    wqqsdtsgtqtanvdsytmhenygagtasysndiailhlatsislggniqaavlpannnn
    dyagttcvisgwgrtdgtnnlpdilqkssipvittaqctaamvgvgganiwdnhicvqdp
    agntgacngdsggplncpdggtrvvgvtswvvssglgaclpdypsvytrvsaylgwigdn
    s